PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010533491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family TALE
Protein Properties Length: 549aa    MW: 61649.7 Da    PI: 7.0758
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010533491.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.72.7e-103974341954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gLt++qV +WF N R +
  XP_010533491.1 397 FEHflHPYPKESEKIMLAKQTGLTKSQVANWFINARVR 434
                     665559******************************88 PP

2BELL121.24.3e-39260331172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erq+lq+kk+kLls+++eVdkrY+qy++q+++++ssFe+vagl +akpYts+Al++iSrhFrcL+dai++qi
  XP_010533491.1 260 ERQDLQSKKSKLLSMVDEVDKRYNQYYHQMEALASSFEMVAGLRAAKPYTSVALNRISRHFRCLRDAIKGQI 331
                     799*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-57182329IPR006563POX domain
PfamPF075268.4E-48188327IPR006563POX domain
PROSITE profilePS5007112.357375438IPR001356Homeobox domain
CDDcd000864.19E-12378439No hitNo description
SMARTSM003892.2E-10378442IPR001356Homeobox domain
SuperFamilySSF466894.71E-18379445IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-29381444IPR009057Homeodomain-like
PfamPF059208.3E-18395434IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MSVYYPGSVT CNRDGMQSLY QEPMYLNQQQ ASSASAATFS DIVNGNGGGG GNCLEIPHAS  60
VRNEMVFIPP NGDVTALQGL NANVTANAVS SSDLSFHGLS LSLGTQIPNA VTVPVPPFQY  120
QYQNMSNHLG FGQNHSLSVK ETLSCDVSES GKDKEMLLGQ PEHMPSSGFS VGFYNNYRYE  180
TSGFVSSVLR SRYLKPAQQL LDEVVSVRKD LKQVNKNKNK GQDFNGLSDS KDTEIGSASN  240
GTASNVSESN MKPPELSPSE RQDLQSKKSK LLSMVDEVDK RYNQYYHQME ALASSFEMVA  300
GLRAAKPYTS VALNRISRHF RCLRDAIKGQ IQIIRGKLGE RENSDDQGER IPRLRYLDQR  360
LRQQRALHQQ LGMVRPAWRP QRGLPENAVT ILRAWLFEHF LHPYPKESEK IMLAKQTGLT  420
KSQVANWFIN ARVRLWKPMI EEMYKEEFGD SEMNSKSYQE NNVSTGQGQD SSHAMSQFKH  480
EDSQSFAGTA TNSAFPEPKP DESQQINRSD YDSLMNYNGF NLDDYRYIGL GNQQDSRFSN  540
PHHLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-17384442563Homeobox protein Meis2
3k2a_B4e-17384442563Homeobox protein Meis2
4xrs_A4e-17384441158Homeobox protein Meis1
4xrs_B4e-17384441158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533508.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010533500.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010533491.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4KK100.0V4KK10_EUTSA; Uncharacterized protein
STRINGAT1G75410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3